PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00031499-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 69aa    MW: 7824.33 Da    PI: 10.618
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00031499-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.21.6e-212667546
                        SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
              SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                        ++s++qvtfskRr+g++KKA EL+v C+ eva+i+fs+++++
  WALNUT_00031499-RA 26 EESKKQVTFSKRRAGLFKKAGELCVVCGLEVAIIVFSPHNNV 67
                        6899**********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.32E-211468IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-181468IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.0351469IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-161636IPR002100Transcription factor, MADS-box
PfamPF003193.1E-212668IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-163651IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-165169IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MVIQKKMSEG KKTRGRQRIE IKELAEESKK QVTFSKRRAG LFKKAGELCV VCGLEVAIIV  60
FSPHNNVFC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015866170.16e-24PREDICTED: agamous-like MADS-box protein AGL62
RefseqXP_013459823.12e-23MADS-box transcription factor family protein
SwissprotQ9FKK21e-21AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A072UVN62e-23A0A072UVN6_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA20G27341.13e-21(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-23AGAMOUS-like 62